BDBM50015490 CHEMBL438945::H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2::NPY::NPY, human::NPY, human, rat::Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY)::human Neuropeptide Y

SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O

InChI Key InChIKey=XKWCTHKJQNUFOQ-UHFFFAOYSA-N

Data  32 KI  9 IC50  1 EC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 42 hits for monomerid = 50015490   

TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0400nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/24/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.0700nMAssay Description:Binding affinity to human neuropeptide Y1 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0760nMAssay Description:Binding affinity to human neuropeptide Y receptor type 2 by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0800nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/22/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.0900nMAssay Description:Binding affinity to human neuropeptide Y2 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0900nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/23/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0900nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2011
Entry Details
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.0960nMAssay Description:Binding affinity to human neuropeptide Y receptor type 1 by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.140nMAssay Description:Binding affinity to human neuropeptide Y receptor type 1 by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.190nMAssay Description:Binding affinity to human neuropeptide Y receptor type 2 by radioligand displacement assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.210nMAssay Description:Displacement of [125I]Peptide YY from neuropeptide Y receptor type 1 in human SK-N-MC cells after 60 minsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.220nMAssay Description:Displacement of [125I]Peptide YY from neuropeptide Y receptor type 1 in human SK-N-MC cells after 60 minsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.230nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/24/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.280nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/2/2012
Entry Details
PubMed
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.420nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/2/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.490nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.5nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 0.5nMAssay Description:Compound was evaluated for its inhibitory activity against Y2 receptor of rabbit kidney membraneMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/17/2010
Entry Details Article

TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.5nMAssay Description:Displacement of Cy5-pNPY from human Y1 receptor expressed in HEL cells after 90 to 120 mins by flow cytometryMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.530nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/22/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.540nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2011
Entry Details
PubMed
TargetNeuropeptide Y receptor type 5(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.600nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/24/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 5(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.730nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.790nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/2/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  0.800nMAssay Description:Displacement of Cy5-pNPY from human Y2 receptor expressed in CHO cells after 90 to 120 mins by flow cytometryMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 1.20nMAssay Description:Inhibition of neuropeptide Y1 receptor in human SK-N-MC cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/29/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  1.20nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/2/2012
Entry Details
PubMed
TargetNeuropeptide Y receptor type 5(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  1.5nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/2/2012
Entry Details
PubMed
TargetNeuropeptide Y receptor type 2(Mouse)
Merck Research Laboratories

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  1.80nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/21/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 4(Human)
Synaptic Pharmaceutical

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  2.08nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/23/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 5(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  2.20nMAssay Description:Displacement of Cy5-pNPY from human Y5 receptor expressed in human HEC-1B cells after 90 to 120 mins by flow cytometryMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  2.30nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/22/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 1(Human)
Institute of Organic Synthesis

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 2.60nMAssay Description:Displacement of [125I]-NPY from Y1 receptor in human MCF7 cells in presence of 1 uM BBNMore data for this Ligand-Target Pair
In Depth
Date in BDB:
9/24/2013
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 5(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataIC50: 3nMAssay Description:Inhibition of [125I]-PYY binding to recombinant NPY Y5 receptor on HEK293 cell membranes.More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/10/2009
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 2(Human)
Federal Institute of Technology of Zurich

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  3.20nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/22/2011
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 5(Mouse)
Merck Research Laboratories

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  4.30nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/21/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 4(Human)
Synaptic Pharmaceutical

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  5.80nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/24/2012
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 4(Human)
Synaptic Pharmaceutical

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  282nMAssay Description:Displacement of Cy5-[K4]hPP from human Y4 receptor expressed in CHO cells after 90 to 120 mins by flow cytometryMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetNeuropeptide Y receptor type 4(Human)
Synaptic Pharmaceutical

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataEC50:  417nMAssay Description:Agonist activity at human Y4 receptor expressed in sf9 cells assessed as hydrolysis of [gamma-33P]GTP after 2 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/13/2014
Entry Details Article
PubMed
TargetPro-FMRFamide-related neuropeptide FF(Rat)
Juvantia Pharma

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  920nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/24/2012
Entry Details Article
PubMed
TargetPro-neuropeptide Y(Rat)
Amgen

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  1.00E+3nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/21/2012
Entry Details Article
PubMed
TargetNeuropeptide FF receptor 2(Rat)
Juvantia Pharma

Curated by PDSP Ki Database
LigandChemical structure of BindingDB Monomer ID 50015490BDBM50015490(NPY, human, rat | CHEMBL438945 | NPY | H-YPSKPDNPG...)
Affinity DataKi:  4.00E+3nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/24/2012
Entry Details Article
PubMed