BDBM50043385 CHEMBL3355072
SMILES C[C@@H]1Cn2ncc(c2CN1c1ccnc2[nH]ccc12)-c1ccc(cc1)S(C)(=O)=O
InChI Key InChIKey=UFZMEAYSFGBIBJ-UHFFFAOYSA-N
Data 6 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 6 hits for monomerid = 50043385
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.300nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 130nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 140nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 80nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1.50E+3nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
