BDBM50270298 CHEMBL4075720
SMILES CN1CCN(Cc2ccc(NC(=O)c3n[nH]cc3Nc3ncnc4sccc34)cc2)CC1
InChI Key InChIKey=UDVJBRYBBSVDDS-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 29 hits for monomerid = 50270298
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 0.600nMAssay Description:Inhibition of human FLT3 by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataKd: 0.230nMAssay Description:Binding affinity to human FLT3 ITD/D835V double mutant expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human FLT3 R595_E596 mutant by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human FLT3 ITD-W51 mutant by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 18nMAssay Description:Inhibition of human FLT3 ITD-NPOS mutant by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 7.40nMAssay Description:Inhibition of human FLT3 F594_R595insREY mutant by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.30nMAssay Description:Inhibition of CDK6 (unknown origin) by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 9.10nMAssay Description:Inhibition of CDK2 (unknown origin) by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 1.20nMAssay Description:Inhibition of human FLT3 F594_R595insR mutant by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of human ERK7 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 10nMAssay Description:Inhibition of human CDK6/Cyclin-D1 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of human CDK2/Cyclin-A at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human FLT4 by Hotspot assayMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 35nMAssay Description:Inhibition of human KDR by Hotspot assayMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of human FLT1 by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 94nMAssay Description:Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins b...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 0.540nMAssay Description:Inhibition of human FLT3 D835Y mutant by Hotspot assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 10nMAssay Description:Inhibition of human CDK4/Cyclin-D1 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataKd: 1.30nMAssay Description:Binding affinity to human FLT3 ITD/F691L double mutant expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataKd: 7nMAssay Description:Binding affinity to human FLT3 D835Y mutant (Q580 to Y969 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 13nMAssay Description:Inhibition of human FLT3 Y591-V592 mutant by Hotspot assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 96nMAssay Description:Inhibition of human CDK1/Cyclin E using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins ...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of human CDK9/Cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 0.438nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filt...More data for this Ligand-Target Pair
Affinity DataIC50: 5.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 3.30nMAssay Description:Inhibition of human CDK4/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 4.20nMAssay Description:Inhibition of human CDK6/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins ...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 35nMAssay Description:Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins b...More data for this Ligand-Target Pair
