BDBM50361644 CHEMBL1940253
SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCN([C@@H]3c3ccccc3)C(C)=O)n2)c2c(N)ncnc12
InChI Key InChIKey=WAJYOJVNNBMVIM-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 11 hits for monomerid = 50361644
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataIC50: 200nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human SKOV3 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 300nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 320nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 820nMAssay Description:Inhibition of Aurora AMore data for this Ligand-Target Pair
Affinity DataIC50: 860nMAssay Description:Inhibition of GSK3-betaMore data for this Ligand-Target Pair
Affinity DataKi: 1.10E+3nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of MARK1More data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mouse)
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 1.90E+3nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
