BDBM50557748 CHEMBL4745367
SMILES CNc1ccn2ncc(-c3cccc(OC)c3)c2n1
InChI Key InChIKey=ZJCYAMJZCUOTFJ-UHFFFAOYSA-N
Data 2 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 2 hits for monomerid = 50557748
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
