BDBM50559295 CHEMBL4741075
SMILES CC(C)n1cc(cn1)-c1nc(Nc2ccc3CCN(Cc3c2)C(=O)\C=C\C(=O)c2ccccc2)ncc1C
InChI Key InChIKey=XYGKXJMVLXBHIE-UHFFFAOYSA-N
Data 8 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 8 hits for monomerid = 50559295
Affinity DataIC50: 43nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 61nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 535nMAssay Description:Inhibition of FLT3 ITD mutant in human MOLM13 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 89nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 52nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 16nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
