BDBM50570299 CHEMBL4879020
SMILES CNc1nc(C)c(s1)-c1nc(Nc2cccc(c2)N2CCNCC2)ncc1C
InChI Key InChIKey=GZDFPDSMIHMTRU-UHFFFAOYSA-N
Data 4 KI
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 50570299
Affinity DataKi: 8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 472nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Affinity DataKi: 711nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1.12E+3nMAssay Description:Inhibition of recombinant human full length CDK1/Cyclin B using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
