BDBM50602427 CHEMBL5206101
SMILES FC1(F)C[C@H]1C(=O)N1CCC2(C1)CCC(CC2)c1cccc2nc(NC(=O)C3CC3)nn12
InChI Key InChIKey=DVLBRDUTBJVBQN-UHFFFAOYSA-N
Data 11 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 11 hits for monomerid = 50602427
Affinity DataIC50: 31nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 324nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Affinity DataIC50: 5.76E+3nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 67nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP1A2 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2B6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C8 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 4.90E+4nMAssay Description:Inhibition of CYP2C9 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 6.43E+4nMAssay Description:Inhibition of CYP2C19 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2D6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP3A4 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
