BDBM570070 US11427581, Compound 4-2

SMILES FC1(F)CC1C(=O)NC1CCC(CC1)c1cccc2nc(NC(=O)C3CC3)nn12

InChI Key InChIKey=JQKDWSJGLLIFBM-UHFFFAOYSA-N

Data  8 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 570070   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 3nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
Go to US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 23nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
Go to US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 2.05E+3nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
Go to US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 10nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
Go to US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 23nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 2.05E+3nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed