BDBM570080 US11427581, Compound 8-4

SMILES FC1(F)C[C@@H]1C(=O)N[C@H]1CCC(CC1)c1cccc2nc(NC(=O)C3CC3)nn12

InChI Key InChIKey=JQKDWSJGLLIFBM-UHFFFAOYSA-N

Data  4 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 570080   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570080(US11427581, Compound 8-4)
Affinity DataIC50: 442nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570080(US11427581, Compound 8-4)
Affinity DataIC50: 2.44E+3nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570080(US11427581, Compound 8-4)
Affinity DataIC50: 3.75E+3nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570080(US11427581, Compound 8-4)
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent