BDBM148264 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide::Kisqali::LEE011::Ribociclib::US10570141, Comparative Example 1::US8962630, 74

SMILES CN(C)C(=O)c1cc2cnc(nc2n1C3CCCC3)Nc4ccc(cn4)N5CCNCC5

InChI Key InChIKey=RHXHGRAEPCAFML-UHFFFAOYSA-N

Data  45 IC50

PDB links: 1 PDB ID matches this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 51 hits for monomerid = 148264   

TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.14nMAssay Description:LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/30/2020
Entry Details
US Patent

TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of human CDK4 incubated for 18 hrs by microscopic analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/18/2024
Entry Details
PubMed
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMpH: 7.5 T: 2°CAssay Description:A 384-well microtiter Lance TR-FRET (time-resolved-fluorescence energy transfer) endpoint assay was used for CDK4/cyclin D1 kinase activity measureme...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2015
Entry Details
US Patent

TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/12/2025
Entry Details
PubMed
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetPlatelet-derived growth factor receptor alpha/beta(Mouse)
University of Milan

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4/CyclinD1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCyclin-dependent kinase 4(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/16/2016
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
University of Padova

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4/CyclinD1 (unknown origin) assessed as reduction in retinoblastoma phosphorylation at S473 residue by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 13nMAssay Description:Inhibition of human CDK4/CyclinD3 by enzymatic radiometric assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2020
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant human full length N-terminal GST-tagged CDK4/Cyclin-D3 co-expressed in baculovirus infected sf21 cells using Rb substrate i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/24/2019
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Human)
Peking Union Medical College

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/23/2022
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
University of Padova

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 23nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/23/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 26.9nMAssay Description:LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/30/2020
Entry Details
US Patent
PDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 28nMAssay Description:Inhibition of CDK6/Cyclin-D3 (unknown origin) using histoneH1 as substrate after 90 mins by ADP-Glo assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
University of Padova

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 29nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
University of Padova

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 30nMAssay Description:Inhibition of GST-tagged CDK4/cyclin D1 (unknown origin) expressed in Baculovirus infected Sf9 cells using RPPTLSPIPHIPR peptide as substrate in pres...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
University of Padova

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 30nMAssay Description:Inhibition of human CDK4/cyclin D (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/16/2016
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/12/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of human CDK6 incubated for 18 hrs by microscopic analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/18/2024
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6(Human)
Central University of Punjab

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetPlatelet-derived growth factor receptor alpha/beta(Mouse)
University of Milan

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 51nMAssay Description:Inhibition of CDK4/Cyclin D1 in human MCF7 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
10/12/2025
Entry Details
PubMed
TargetPlatelet-derived growth factor receptor alpha/beta(Mouse)
University of Milan

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 60nMAssay Description:Inhibition of CDK6/Cyclin D1 in human MCF7 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
10/12/2025
Entry Details
PubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 71nMAssay Description:Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scinti...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2021
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 73nMAssay Description:Inhibition of CDK6/Cyclin D (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 197nMAssay Description:Inhibition of human CDK9/CyclinT1 by enzymatic radiometric assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2020
Entry Details Article
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2021
Entry Details Article
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant human full length C-terminal 6His-tagged CDK9/Cyclin-T1 co-expressed in baculovirus infected sf21 cells using PDKtide subst...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/24/2019
Entry Details Article
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Nankai University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 3.90E+3nMAssay Description:Inhibition of GST-tagged CDK9/CyclinT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as substr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 1.50E+4nMAssay Description:The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2015
Entry Details
US Patent

TargetCyclin-dependent kinase 1(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 1.50E+4nMT: 2°CAssay Description:A 384-well microtiter IMAP-FPT (Molecular Devices Trade Mark Technology) endpoint assay was used for CDK1/cyclin B kinase activity measurements. The ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2015
Entry Details
US Patent

TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
Shanghaitech University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of CDK1/cyclin B1 (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addition ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of human CDK2/cyclin E (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK7/cyclinH/MAT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as su...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
Shanghaitech University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of His-tagged CDK1/cyclin B1 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [ga...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
Palack£

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK2/cyclin A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate in presence of [gamma-33P]-ATP b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
Palack£

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK5/p25 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate as substrate in presence...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of His-tagged CDK2/cyclin E (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [gam...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 1(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
Palack£

Curated by ChEMBL
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 7.60E+4nMAssay Description:Inhibition of CDK2/CyclinA (unknown origin) assessed as reduction in TAMRA tagged peptide substrate phosphorylation by fluorescence polarization assa...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/20/2021
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2(Human)
Novartis

US Patent
LigandPNGBDBM148264(US8962630, 74 | Ribociclib | LEE011 | Kisqali | 7-...)
Affinity DataIC50: 7.60E+4nMAssay Description:The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2015
Entry Details
US Patent

Displayed 1 to 50 (of 51 total ) | Next | Last >>