BDBM50557757 CHEMBL4792464
SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)[C@H]1COC(C)(C)C1
InChI Key InChIKey=PETJVBHONPBYQW-UHFFFAOYSA-N
Data 2 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
 Found 2 hits  for monomerid = 50557757
 Found 2 hits  for monomerid = 50557757    
Affinity DataIC50: 3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Affinity DataIC50: 4.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
