Report error Found 337 Enz. Inhib. hit(s) with all data for entry = 50022646
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.0300nMAssay Description:Inhibition of human CAMK2a using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.0370nMAssay Description:Inhibition of human CAMK2d using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 0.0490nMAssay Description:Inhibition of human PIM3 using RSRHSSYPAGT as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.0600nMAssay Description:Inhibition of human CAMK2b using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetTestis-specific serine/threonine-protein kinase 1(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.0610nMAssay Description:Inhibition of human STK22D using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured afte...More data for this Ligand-Target Pair
Affinity DataIC50: 0.0790nMAssay Description:Inhibition of human JAK3 using GGEEEEYFELVKKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 0.0860nMAssay Description:Inhibition of human RSK2 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
Affinity DataIC50: 0.102nMAssay Description:Inhibition of human RSK4 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measur...More data for this Ligand-Target Pair
Affinity DataIC50: 0.108nMAssay Description:Inhibition of human RSK3 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
Affinity DataIC50: 0.112nMAssay Description:Inhibition of human TRKB using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.118nMAssay Description:Inhibition of human RSK1 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 3(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.135nMAssay Description:Inhibition of human GLK/MAP4K3 using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured aft...More data for this Ligand-Target Pair
TargetMAP/microtubule affinity-regulating kinase 4(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.135nMAssay Description:Inhibition of human MARK4 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
Affinity DataIC50: 0.139nMAssay Description:Inhibition of human PAR-1Ba using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured aft...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase ROS(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.141nMAssay Description:Inhibition of human ROS using KKKSPGEYVNIEFG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.177nMAssay Description:Inhibition of human TYK2 using KKSRGDYMTMQIG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
Affinity DataIC50: 0.178nMAssay Description:Inhibition of human JAK2 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.193nMAssay Description:Inhibition of human PKCd using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 min...More data for this Ligand-Target Pair
Affinity DataIC50: 0.195nMAssay Description:Inhibition of human CHK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.199nMAssay Description:Inhibition of human PKN1 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
Affinity DataIC50: 0.207nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.230nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type 1D(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.243nMAssay Description:Inhibition of human CAMK1d using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 0.251nMAssay Description:Inhibition of human PKCeta using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
Affinity DataIC50: 0.286nMAssay Description:Inhibition of human PKCepsilon using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 1...More data for this Ligand-Target Pair
Affinity DataIC50: 0.306nMAssay Description:Inhibition of human SIK2 using AMARAASAAALARRR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.308nMAssay Description:Inhibition of human KHS using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.315nMAssay Description:Inhibition of human PKCa using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 min...More data for this Ligand-Target Pair
Affinity DataIC50: 0.328nMAssay Description:Inhibition of human PAK3 using RRRLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
Affinity DataIC50: 0.328nMAssay Description:Inhibition of human MARK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
Affinity DataIC50: 0.350nMAssay Description:Inhibition of human FER using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.365nMAssay Description:Inhibition of human IKKe using casein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by radio...More data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.366nMAssay Description:Inhibition of human CAMK2g using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetMAP/microtubule affinity-regulating kinase 3(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.380nMAssay Description:Inhibition of human MARK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
Affinity DataIC50: 0.392nMAssay Description:Inhibition of human SIK1 using AMARAASAAALARRR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 4(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.427nMAssay Description:Inhibition of human HGK using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.437nMAssay Description:Inhibition of human PAK1 using RRRLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 2(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.481nMAssay Description:Inhibition of human GCK using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase MRCK gamma(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.484nMAssay Description:Inhibition of human DMPK2 using KKRPQRRYSNVF as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.486nMAssay Description:Inhibition of human PHKg2 using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.537nMAssay Description:Inhibition of human p70S6K using KKRNRTLTK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.553nMAssay Description:Inhibition of human MSK1 using GRPRTSSFAEG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.556nMAssay Description:Inhibition of human PDK1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and...More data for this Ligand-Target Pair
TargetTRAF2 and NCK-interacting protein kinase(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.559nMAssay Description:Inhibition of human TNIK using RLGRDKYKTLRQIRQ as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor alpha(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.577nMAssay Description:Inhibition of human PDGFRa using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 12...More data for this Ligand-Target Pair
Affinity DataIC50: 0.581nMAssay Description:Inhibition of human MINK1 using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 12...More data for this Ligand-Target Pair
Affinity DataIC50: 0.584nMAssay Description:Inhibition of human STK38 using KKRNRRLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.587nMAssay Description:Inhibition of human JAK1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
TargetDiscoidin domain-containing receptor 2(Human)
Center for Lymphoid Malignancies
Curated by ChEMBL
Center for Lymphoid Malignancies
Curated by ChEMBL
Affinity DataIC50: 0.650nMAssay Description:Inhibition of human DDR2 using KKSRGDYMTMQIG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
Affinity DataIC50: 0.723nMAssay Description:Inhibition of human TAOK1 using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 12...More data for this Ligand-Target Pair

3D Structure (crystal)