Report error Found 160 Enz. Inhib. hit(s) with all data for entry = 50012669
Affinity DataIC50: 0.900nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 7nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 16nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 18nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 23nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 23nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Affinity DataIC50: 24nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 25nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 25nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 26nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 28nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 30nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 30nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 34nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Affinity DataIC50: 41nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 42nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 43nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 43nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 45nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Affinity DataIC50: 47nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 50nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Affinity DataIC50: 51nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 52nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 52nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Affinity DataIC50: 54nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 56nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Affinity DataIC50: 58nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 60nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 61nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 62nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Affinity DataIC50: 72nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 72nMAssay Description:Inhibition of FLT3 ITD mutant in human MOLM13 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 73nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University
Curated by ChEMBL
West China Hospital of Sichuan University
Curated by ChEMBL
Affinity DataIC50: 75nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Affinity DataIC50: 76nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Affinity DataIC50: 77nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair










