Report error Found 67 Enz. Inhib. hit(s) with all data for entry = 50013854
Affinity DataKi: 3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 9nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 11nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 12nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 12nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 14nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 19nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 20nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 21nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 22nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 22nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 25nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 32nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 34nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 40nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 43nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 44nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 45nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 47nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 49nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 52nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 55nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 62nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 70nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 87nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 87nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 89nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Affinity DataKi: 91nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 95nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 107nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 125nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 128nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 187nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Affinity DataKi: 248nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 281nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 444nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Affinity DataKi: 472nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair






























