Compile Data Set for Download or QSAR
Report error Found 40 Enz. Inhib. hit(s) with all data for entry = 50023771
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246253BDBM50246253(AZD-5438 | 4-(1-isopropyl-2-methyl-1H-imidazol-5-y...)
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK2/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataIC50: 6.5nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246253BDBM50246253(AZD-5438 | 4-(1-isopropyl-2-methyl-1H-imidazol-5-y...)
Affinity DataIC50: 12nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668138BDBM50668138(CHEMBL6191905)
Affinity DataIC50: 17nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668134BDBM50668134(CHEMBL6189485)
Affinity DataIC50: 21nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668120BDBM50668120(CHEMBL6190697)
Affinity DataIC50: 28nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668133BDBM50668133(CHEMBL6189206)
Affinity DataIC50: 30nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 1(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246253BDBM50246253(AZD-5438 | 4-(1-isopropyl-2-methyl-1H-imidazol-5-y...)
Affinity DataIC50: 35nMAssay Description:Inhibition of CDK1/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668140BDBM50668140(CHEMBL6192125)
Affinity DataIC50: 36nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668121BDBM50668121(CHEMBL6190474)
Affinity DataIC50: 36nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246253BDBM50246253(AZD-5438 | 4-(1-isopropyl-2-methyl-1H-imidazol-5-y...)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK4/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668123BDBM50668123(CHEMBL6191734)
Affinity DataIC50: 46nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668144BDBM50668144(CHEMBL6191877)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668145BDBM50668145(CHEMBL6189279)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668146BDBM50668146(CHEMBL6190887)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668147BDBM50668147(CHEMBL6192397)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668141BDBM50668141(CHEMBL6192231)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668142BDBM50668142(CHEMBL6189866)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668143BDBM50668143(CHEMBL6188316)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668122BDBM50668122(CHEMBL6191243)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668124BDBM50668124(CHEMBL6193624)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668148BDBM50668148(CHEMBL6193029)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668149BDBM50668149(CHEMBL6192414)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668129BDBM50668129(CHEMBL6190392)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668130BDBM50668130(CHEMBL6193277)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668131BDBM50668131(CHEMBL6190171)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668132BDBM50668132(CHEMBL6190120)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668125BDBM50668125(CHEMBL6190889)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668126BDBM50668126(CHEMBL6191973)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668127BDBM50668127(CHEMBL6192962)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668128BDBM50668128(CHEMBL6190878)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668139BDBM50668139(CHEMBL6189323)
Affinity DataIC50: 50nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668135BDBM50668135(CHEMBL6190069)
Affinity DataIC50: 59nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668136BDBM50668136(CHEMBL6192709)
Affinity DataIC50: 88nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using [protein fragment, 39 aa] as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50246253BDBM50246253(AZD-5438 | 4-(1-isopropyl-2-methyl-1H-imidazol-5-y...)
Affinity DataIC50: 167nMAssay Description:Inhibition of CDK6/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataIC50: 1.18E+3nMAssay Description:Inhibition of CDK2/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataIC50: 1.82E+3nMAssay Description:Inhibition of CDK4/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 1(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataIC50: 3.87E+3nMAssay Description:Inhibition of CDK1/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataIC50: 7.94E+3nMAssay Description:Inhibition of CDK6/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50668137BDBM50668137(CHEMBL6193682)
Affinity DataKd:  8.87E+3nMAssay Description:Binding affinity to CDK9/cyclin T1 (unknown origin) assessed as dissociation constant by SPR analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
6/6/2026
Entry Details
PubMed