Compile Data Set for Download or QSAR
Report error Found 92 Enz. Inhib. hit(s) with all data for entry = 10795
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570078(US11427581, Compound 8-2)
Affinity DataIC50: 2nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 3nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 10nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570066(US11427581, Compound 3-1)
Affinity DataIC50: 12nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570069(US11427581, Compound 3-4)
Affinity DataIC50: 17nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570060(US11427581, Compound 1-7)
Affinity DataIC50: 20nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570078(US11427581, Compound 8-2)
Affinity DataIC50: 22nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 23nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570078(US11427581, Compound 8-2)
Affinity DataIC50: 24nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570071(US11427581, Compound 4-3)
Affinity DataIC50: 31nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570063(US11427581, Compound 1-10)
Affinity DataIC50: 40nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570074(US11427581, Compound 6-1)
Affinity DataIC50: 70nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570069(US11427581, Compound 3-4)
Affinity DataIC50: 71nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570060(US11427581, Compound 1-7)
Affinity DataIC50: 73nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570066(US11427581, Compound 3-1)
Affinity DataIC50: 78nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570065(US11427581, Compound 5-4 | US11427581, Compound 1-...)
Affinity DataIC50: 90nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570077(US11427581, Compound 8-1)
Affinity DataIC50: 111nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570069(US11427581, Compound 3-4)
Affinity DataIC50: 126nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570071(US11427581, Compound 4-3)
Affinity DataIC50: 127nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570072(US11427581, Compound 5-3)
Affinity DataIC50: 132nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570066(US11427581, Compound 3-1)
Affinity DataIC50: 141nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570082(US11427581, Compound 10-10 | US11427581, Compound ...)
Affinity DataIC50: 145nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570065(US11427581, Compound 5-4 | US11427581, Compound 1-...)
Affinity DataIC50: 149nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570067(US11427581, Compound 3-2)
Affinity DataIC50: 163nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570068(US11427581, Compound 3-3)
Affinity DataIC50: 166nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570065(US11427581, Compound 5-4 | US11427581, Compound 1-...)
Affinity DataIC50: 178nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570064(US11427581, Compound 1-11)
Affinity DataIC50: 182nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570062(US11427581, Compound 1-9)
Affinity DataIC50: 186nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570074(US11427581, Compound 6-1)
Affinity DataIC50: 208nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570061(US11427581, Compound 1-8)
Affinity DataIC50: 209nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570063(US11427581, Compound 1-10)
Affinity DataIC50: 215nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570076(US11427581, Compound 6-3)
Affinity DataIC50: 236nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570060(US11427581, Compound 1-7)
Affinity DataIC50: 239nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570074(US11427581, Compound 6-1)
Affinity DataIC50: 244nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570082(US11427581, Compound 10-10 | US11427581, Compound ...)
Affinity DataIC50: 245nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570082(US11427581, Compound 10-10 | US11427581, Compound ...)
Affinity DataIC50: 259nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570081(US11427581, Compound 8-5)
Affinity DataIC50: 291nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570071(US11427581, Compound 4-3)
Affinity DataIC50: 360nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570065(US11427581, Compound 5-4 | US11427581, Compound 1-...)
Affinity DataIC50: 422nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570080(US11427581, Compound 8-4)
Affinity DataIC50: 442nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570063(US11427581, Compound 1-10)
Affinity DataIC50: 445nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570072(US11427581, Compound 5-3)
Affinity DataIC50: 462nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570079(US11427581, Compound 8-3)
Affinity DataIC50: 494nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570065(US11427581, Compound 5-4 | US11427581, Compound 1-...)
Affinity DataIC50: 497nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570075(US11427581, Compound 6-2)
Affinity DataIC50: 531nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570077(US11427581, Compound 8-1)
Affinity DataIC50: 633nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570072(US11427581, Compound 5-3)
Affinity DataIC50: 671nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570061(US11427581, Compound 1-8)
Affinity DataIC50: 729nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570076(US11427581, Compound 6-3)
Affinity DataIC50: 778nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

US Patent
LigandPNGBDBM570082(US11427581, Compound 10-10 | US11427581, Compound ...)
Affinity DataIC50: 835nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
In Depth
Date in BDB:
11/7/2022
Entry Details
US Patent

Displayed 1 to 50 (of 92 total ) | Next | Last >>
Jump to: