Details for Substrate
biotinylated-ATF2 without Explicit Binding Affinity Data |
Binding Enzyme 1: | Isoform Alpha-1 of Mitogen-activated protein kinase 10 (Alpha-1) 9-402] |
Binding Enzyme 2: | Mitogen-activated protein kinase 8 |
Synonyms: |
Activating transcription factor 2
|
Cyclic AMP-dependent transcription factor ATF-2
|
cAMP response element-binding protein CRE-BP1
|
Type: | Other Protein Type |
Topology: | n/a |
Mol. Mass.: | 13150.37 Dalton |
Organism: | Human |
Description: | ATF-2 (aa 1-115) was expressed and purified from E. coli. |
Residue: | 115 |
Sequence: | MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLA |
|