Details for Substrate biotinylated-ATF2 without Explicit Binding Affinity Data
Binding Enzyme 1: Isoform Alpha-1 of Mitogen-activated protein kinase 10 (Alpha-1) 9-402]
Binding Enzyme 2: Mitogen-activated protein kinase 8
Synonyms:  Activating transcription factor 2 | Cyclic AMP-dependent transcription factor ATF-2 | cAMP response element-binding protein CRE-BP1
Type: Other Protein Type
Topology: n/a
Mol. Mass.: 13150.37 Dalton
Organism: Human
Description: ATF-2 (aa 1-115) was expressed and purified from E. coli.
Residue: 115
Sequence: MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: